In Stock

Cagrilintide, Semaglutide (Blend)

Price range: $64.00 through $120.00
Add to Cart
Cagrilintide, Semaglutide (Blend)
Cagrilintide, Semaglutide (Blend)
$64.00 $120.00Price range: $64.00 through $120.00
Order this product by 12:00 PM EST and it will be shipped to you today!

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of usage.

 

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

What is this product?

This is a lab-synthesized peptide derived from a sequence. Researchers frequently examine it in controlled studies.

Product Specifications

Bottle
vial – sealed – flip top
Vial size
3ml
Form
powder (lyophilized)
Not reconstituted

Test Results

Sample: Cagrilinitide, Semaglutide 5/5mg

Date Tested:
October 4, 2025
Endotoxins(LPS):
Pass

Certificate of Analysis

Certificate of Analysis (Endotoxin)

Third-party tested for ~99% purity

Cagrilintide Properties

  • Source: PubChem
  • Form: Lyophilized powder
  • Unit size: 2.5,5mg/vial
  • Unit quantity: 1 vial
  • Molecular formula: C194H312N54O59S2
  • Molecular weight: 4409 g/mol
  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
  • CAS number: 1415456-99-3

Semaglutide Properties

  • Source: PubChem
  • Form: Lyophilized powder
  • Unit size: 2.5/5mg/vial
  • Unit quantity: 1 vial
  • Molecular formula: C187H291N45O59
  • Molecular weight: 4114 g/mol
  • Synonym: NN9535
  • Sequence: H-His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(AEEAc-AEEAc-γ-Glu-17-carboxyheptadecanoyl)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-OH
  • CAS number: 910463-68-2

Frequently Asked Questions

Does the product come with instructions?
Yes, each product includes detailed reconstitution and storage instructions.
What's the actual amount in each vial?
Each vial contains the exact amount stated. All products are third-party tested.
Are additional supplies needed?
You'll need bacteriostatic water for reconstitution, insulin syringes, and alcohol swabs.

Have questions about Cagrilintide, Semaglutide (Blend)?

Text us: +1 (877) 871-2284

Verified customer reviews

Customer reviews

All reviews (0)

No verified reviews have been published yet.

Related Products

How It Works

1

Precision Synthesis

Made in a controlled, U.S based facility under strict manufacturing standards.
2

Verified Purity

Every batch is third-party tested with HPLC and MS to confirm chemical integrity.
3

Same-Day Fulfillment

Products are dispatched same-day from our U.S. facility.
Join Waitlist We will inform you when the product arrives in stock. Please leave your valid email address below.