This is a lab-synthesized peptide derived from a sequence. Researchers frequently examine it in controlled studies.
In Stock
FOX04-DRI (10mg)
10mg • Single Vial
$200.00
In stock
| Quantity | Per Item Price | |
|---|---|---|
| 1-2 | 0% | $200.00 |
| 3-5 | 5% | $190.00 |
| 6-10 | 10% | $180.00 |
| 11-20 | 15% | $170.00 |
| 21+ | 25% | $150.00 |
Order this product by 12:00 PM EST and it will be shipped to you today!
Research Use Only
DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of usage.
Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.
What is this product?
Product Specifications
Bottle
vial – sealed – flip top
Vial size
3ml
Form
powder (lyophilized)
Not reconstituted
Test Results
Sample: FOX04-DRI 10mg
Weight:
9.59
Endotoxins(LPS):
Pass
🏆
Certificate of Analysis
Certificates of Analysis
Third-party tested for ~99% purity
FOX04-DRI Properties
- Form: Lyophilized powder
- Unit size: 10mg/vial
- Unit quantity: 1 vial
- Molecular formula: C228H388N86O64
- Molecular weight: 5358.05 g/mol
- Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
- CAS number: 2460055-10-9
Frequently Asked Questions
Does the product come with instructions?
Yes, each product includes detailed reconstitution and storage instructions.
What's the actual amount in each vial?
Each vial contains the exact amount stated. All products are third-party tested.
Are additional supplies needed?
You'll need bacteriostatic water for reconstitution, insulin syringes, and alcohol swabs.
Have questions about FOX04-DRI (10mg)?
Related Products
How It Works
1
Precision Synthesis
Made in a controlled, U.S based facility under strict manufacturing standards.
2
Verified Purity
Every batch is third-party tested with HPLC and MS to confirm chemical integrity.
3
Same-Day Fulfillment
Products are dispatched same-day from our U.S. facility.
