24/7 Support
Manufactured in the USA
Batch Produced, Batch Tested
Fast and Discreet Shipping
Affordable Pricing
24/7 Support
Manufactured in the USA
Batch Produced, Batch Tested
Fast and Discreet Shipping
Affordable Pricing
In Stock

Tesa, Ipamorelin, CJC 1295 no DAC (6/3/3 mg Blend)

Original price was: $90.00.Current price is: $72.00.

In stock

Quantity Per Item Price
1-2 $72.00
3-5 $68.40
6-10 $64.80
11-20 $61.20
21+ $54.00
Add to Cart
Tesa, Ipamorelin, CJC 1295 no DAC (6/3/3 mg Blend)
Tesa, Ipamorelin, CJC 1295 no DAC (6/3/3 mg Blend)
$90.00 Original price was: $90.00.$72.00Current price is: $72.00.
Order this product by 12:00 PM EST and it will be shipped to you today!

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of usage.

 

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

What is this product?

This is a lab-synthesized peptide derived from a sequence. Researchers frequently examine it in controlled studies.

Product Specifications

Bottle
vial – sealed – flip top
Vial size
3ml
Form
powder (lyophilized)
Not reconstituted

Test Results

Sample: Tesa, Ipamorelin, CJC 1295 6/3/3mg

Date Tested:
October 4, 2025
Endotoxins(LPS):
Pass

Certificate of Analysis

Certificate of Analysis (Endotoxin)

Third-party tested for ~99% purity

Tesa Properties

  • Source: PubChem
  • Form: Lyophilized powder
  • Unit size: 6mg/vial
  • Unit quantity: 1 vial
  • Molecular formula: C223H370N72O69S
  • Molecular weight: 5196 g/mol
  • Synonym: Tesamorelin acetate
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • CAS number: 901758-09-6

Ipamorelin Properties

  • Source: PubChem
  • Form: Lyophilized powder
  • Unit size: 3mg/vial
  • Unit quantity: 1 vial
  • Molecular formula: C38H49N9O5
  • Molecular weight: 711.9 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys
  • CAS number: 170851-70-4

CJC-1295 Properties

  • Source: PubChem
  • Form: Lyophilized powder
  • Unit size: 3mg/vial
  • Unit quantity: 1 vial
  • Molecular formula: C152H252N44O42
  • Molecular weight: 3367.9 g/mol
  • Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg
  • CAS number: 863288-34-0

Frequently Asked Questions

Does the product come with instructions?
Yes, each product includes detailed reconstitution and storage instructions.
What's the actual amount in each vial?
Each vial contains the exact amount stated. All products are third-party tested.
Are additional supplies needed?
You'll need bacteriostatic water for reconstitution, insulin syringes, and alcohol swabs.

Have questions about Tesa, Ipamorelin, CJC 1295 no DAC (6/3/3 mg Blend)?

Text us: +1 (877) 871-2284

Related Products

How It Works

1

Precision Synthesis

Made in a controlled, U.S based facility under strict manufacturing standards.
2

Verified Purity

Every batch is third-party tested with HPLC and MS to confirm chemical integrity.
3

Same-Day Fulfillment

Products are dispatched same-day from our U.S. facility.
Join Waitlist We will inform you when the product arrives in stock. Please leave your valid email address below.